General Information

  • ID:  hor001873
  • Uniprot ID:  P09566
  • Protein name:  Glucagon-like peptide
  • Gene name:  gcg
  • Organism:  Atractosteus spatula (Alligator gar) (Lepisosteus spatula)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Atractosteus (genus), Lepisosteidae (family), Semionotiformes (order), Holostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGTYTSDVSSYLQDQAAKKFVTWLKQGQDRRE
  • Length:  34
  • Propeptide:  HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGITXXXXXXXXHADGTYTSDVSSYLQDQAAKKFVTWLKQGQDRRE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
  • Mechanism:  X's in the sequence were included by homology with American goosefish sequences.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001873_AF2.pdbhor001873_ESM.pdb

Physical Information

Mass: 451907 Formula: C171H262N50O57
Absent amino acids: CIMNP Common amino acids: DQ
pI: 7.53 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -117.65 Boman Index: -10265
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.82
Instability Index: 4460.59 Extinction Coefficient cystines: 8480
Absorbance 280nm: 256.97

Literature

  • PubMed ID:  3282974
  • Title:  Isolation of Alligator Gar (Lepisosteus Spatula) Glucagon, Oxyntomodulin, and Glucagon-Like Peptide: Amino Acid Sequences of Oxyntomodulin and Glucagon-Like Peptide